Semaglutide 5mg
Semaglutide – Research Peptide
Description:
Semaglutide is a long-acting GLP-1 (glucagon-like peptide-1) receptor agonist developed for research into metabolic regulation. Structurally modified to resist degradation by the enzyme DPP-4, Semaglutide promotes glucose-dependent insulin secretion, reduces appetite, delays gastric emptying, and lowers blood glucose levels in preclinical models. It is widely studied in the context of type 2 diabetes, obesity, and appetite regulation.
Product Details:
- 
Synonyms: NN9535
 - 
Molecular Formula: C187H291N45O59
 - 
Molecular Weight: ~4113.58 g/mol
 - 
CAS Number: 910463-68-2
 - 
Sequence (Amino Acids): HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG (modified)
 - 
Purity: ≥98% (HPLC)
 - 
Form: Lyophilized powder
 - 
Storage: -20°C in a sealed container; protect from light and moisture
 - 
Solubility: Soluble in sterile water or research-grade buffers
 
Intended Use:
This peptide is for laboratory research use only. It is not for human or veterinary use, and not intended for medical, therapeutic, or diagnostic applications.
For Research Use Only. Not for human consumption or therapeutic use.