Semaglutide 10mg

HOT ITEM!!
Semaglutide 10mg
$80.00

Semaglutide – Research Peptide

Description:

Semaglutide is a long-acting GLP-1 (glucagon-like peptide-1) receptor agonist developed for research into metabolic regulation. Structurally modified to resist degradation by the enzyme DPP-4, Semaglutide promotes glucose-dependent insulin secretion, reduces appetite, delays gastric emptying, and lowers blood glucose levels in preclinical models. It is widely studied in the context of type 2 diabetes, obesity, and appetite regulation.

 

 

Product Details:

 

  • Synonyms: NN9535

  • Molecular Formula: C187H291N45O59

  • Molecular Weight: ~4113.58 g/mol

  • CAS Number: 910463-68-2

  • Sequence (Amino Acids): HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG (modified)

  • Purity: ≥98% (HPLC)

  • Form: Lyophilized powder

  • Storage: -20°C in a sealed container; protect from light and moisture

  • Solubility: Soluble in sterile water or research-grade buffers

 

 

 

Intended Use:

This peptide is for laboratory research use only. It is not for human or veterinary use, and not intended for medical, therapeutic, or diagnostic applications.