Tirzepatide 10mg (3pack)
Tirzepatide – Research Peptide
Description:
Tirzepatide is a synthetic 39-amino acid peptide that functions as a dual agonist of both the GIP (glucose-dependent insulinotropic polypeptide) and GLP-1 (glucagon-like peptide-1) receptors. Its unique mechanism of action is being studied for its ability to improve insulin secretion, regulate blood glucose levels, suppress appetite, and support weight loss in preclinical models. Tirzepatide is of high interest in the field of metabolic research, including studies on obesity and type 2 diabetes.
Product Details:
-
Synonyms: LY3298176
-
Molecular Formula: C225H348N48O68
-
Molecular Weight: ~4813.45 g/mol
-
CAS Number: 2023788-19-2
-
Sequence (Amino Acids): Y-Ahx-HGEGTFTSDLSKQMEEEAVRLFIEWLMNTKRNRNNIA
-
Purity: ≥98% (HPLC)
-
Form: Lyophilized powder
-
Storage: -20°C in a sealed container; protect from light and moisture
-
Solubility: Soluble in sterile water or buffer suitable for peptide research
Intended Use:
This product is supplied for laboratory research purposes only. It is not intended for human or animal consumption, medical, or diagnostic use.